DDX17 antibody

Catalog No. ABIN630050

Product Details anti-DDX17 Antibody

Target: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX17 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX17 Blocking Peptide, catalog no. 33R-9297, is also available for use as a blocking control in assays to test for specificity of this DDX17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX17

Target: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Alternative Name: DDX17 (DDX17 Products)

Synonyms: MGC80019 antibody, DDX17 antibody, P72 antibody, RH70 antibody, Cp68 antibody, DDX46 antibody, 2610007K22Rik antibody, A430025E01Rik antibody, AI047725 antibody, C80929 antibody, Gm926 antibody, p72 antibody, DEAD-box helicase 17 L homeolog antibody, probable ATP-dependent RNA helicase DDX17 antibody, DEAD-box helicase 17 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 antibody, ddx17.L antibody, LOC412313 antibody, DDX17 antibody, ddx17 antibody, Ddx17 antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Muscle Cell Differentiation