RPL32 antibody (N-Term)
-
- Target See all RPL32 Antibodies
- RPL32 (Ribosomal Protein L32 (RPL32))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPL32 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPL32 antibody was raised against the N terminal of RPL32
- Purification
- Purified
- Immunogen
- RPL32 antibody was raised using the N terminal of RPL32 corresponding to a region with amino acids AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG
- Top Product
- Discover our top product RPL32 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPL32 Blocking Peptide, catalog no. 33R-1035, is also available for use as a blocking control in assays to test for specificity of this RPL32 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL32 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL32 (Ribosomal Protein L32 (RPL32))
- Alternative Name
- RPL32 (RPL32 Products)
- Background
- RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
- Molecular Weight
- 15 kDa (MW of target protein)
-