HNRNPA3 antibody (N-Term)
-
- Target See all HNRNPA3 Antibodies
- HNRNPA3 (Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPA3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- HNRPA3 antibody was raised against the N terminal of HNRPA3
- Purification
- Purified
- Immunogen
- HNRPA3 antibody was raised using the N terminal of HNRPA3 corresponding to a region with amino acids MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
- Top Product
- Discover our top product HNRNPA3 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPA3 Blocking Peptide, catalog no. 33R-5978, is also available for use as a blocking control in assays to test for specificity of this HNRPA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPA3 (Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3))
- Alternative Name
- HNRPA3 (HNRNPA3 Products)
- Background
- HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
- Molecular Weight
- 42 kDa (MW of target protein)
-