DIS3L2 antibody (N-Term)

Catalog No. ABIN630034

Product Details anti-DIS3L2 Antibody

Target: DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DIS3L2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MGC42174 antibody was raised against the N terminal Of Mgc42174

Purification: Purified

Immunogen: MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC42174 Blocking Peptide, catalog no. 33R-9966, is also available for use as a blocking control in assays to test for specificity of this MGC42174 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC42174 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DIS3L2

Target: DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))

Abstract: DIS3L2 Products

Synonyms: RGD1560168 antibody, DIS3L2 antibody, DKFZp469O0522 antibody, FAM6A antibody, PRLMNS antibody, hDIS3L2 antibody, 4930429A22Rik antibody, 8030493P09Rik antibody, DIS3-like 3'-5' exoribonuclease 2 antibody, DIS3 like 3'-5' exoribonuclease 2 antibody, DIS3-like exonuclease 2 antibody, Dis3l2 antibody, DIS3L2 antibody, LOC100344728 antibody

Background: MGC42174 is a probable exonuclease.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Stem Cell Maintenance