HNRPLL antibody (N-Term)

Catalog No. ABIN630031

Product Details anti-HNRPLL Antibody

Target: HNRPLL (Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRPLL antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: HNRPLL antibody was raised against the N terminal of HNRPLL

Purification: Purified

Immunogen: HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPLL Blocking Peptide, catalog no. 33R-8037, is also available for use as a blocking control in assays to test for specificity of this HNRPLL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPLL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRPLL

Target: HNRPLL (Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL))

Alternative Name: HNRPLL (HNRPLL Products)

Background: HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.

Molecular Weight: 60 kDa (MW of target protein)