RAVER1 antibody (N-Term)

Catalog No. ABIN630030

Product Details anti-RAVER1 Antibody

Target: RAVER1 (Ribonucleoprotein, PTB-Binding 1 (RAVER1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAVER1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RAVER1 antibody was raised against the N terminal of RAVER1

Purification: Purified

Immunogen: RAVER1 antibody was raised using the N terminal of RAVER1 corresponding to a region with amino acids VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAVER1 Blocking Peptide, catalog no. 33R-9845, is also available for use as a blocking control in assays to test for specificity of this RAVER1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAVER1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAVER1

Target: RAVER1 (Ribonucleoprotein, PTB-Binding 1 (RAVER1))

Alternative Name: RAVER1 (RAVER1 Products)

Synonyms: MGC83237 antibody, zgc:112236 antibody, RAVER1 antibody, Raver1h antibody, 1300006N24Rik antibody, AA050359 antibody, mKIAA1978 antibody, hypothetical protein antibody, ribonucleoprotein, PTB-binding 1 S homeolog antibody, ribonucleoprotein, PTB-binding 1 antibody, ribonucleoprotein, PTB binding 1 antibody, Raver1 antibody, raver1.S antibody, raver1 antibody, RAVER1 antibody

Background: RAVER1 contains 3 RRM (RNA recognition motif) domains. It cooperates with PTBP1 to modulate regulated alternative splicing events and promotes exon skipping.

Molecular Weight: 67 kDa (MW of target protein)