RBM4B antibody (C-Term)

Catalog No. ABIN630027

Product Details anti-RBM4B Antibody

Target: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM4B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RBM4 B antibody was raised against the C terminal of RBM4

Purification: Purified

Immunogen: RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM4B Blocking Peptide, catalog no. 33R-1001, is also available for use as a blocking control in assays to test for specificity of this RBM4B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM4B

Target: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Alternative Name: RBM4B (RBM4B Products)

Synonyms: RBM30 antibody, RBM4L antibody, ZCCHC15 antibody, ZCCHC21B antibody, ZCRB3B antibody, 4921506I22Rik antibody, AI504630 antibody, AI506404 antibody, Lark2 antibody, rbm4 antibody, rbm30 antibody, rbm4l antibody, zcrb3b antibody, zcchc15 antibody, MGC75893 antibody, RBM4B antibody, RNA binding motif protein 4B antibody, RNA binding motif protein 4B L homeolog antibody, RNA-binding protein 4B antibody, RBM4B antibody, Rbm4b antibody, rbm4b antibody, rbm4b.L antibody, LOC713553 antibody, LOC102180196 antibody, LOC100058729 antibody

Background: RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Photoperiodism