MTHFSD antibody (N-Term)

Catalog No. ABIN630026

Product Details anti-MTHFSD Antibody

Target: MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTHFSD antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MTHFSD antibody was raised against the N terminal of MTHFSD

Purification: Purified

Immunogen: MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL

Application Details

Application Notes: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTHFSD Blocking Peptide, catalog no. 33R-2798, is also available for use as a blocking control in assays to test for specificity of this MTHFSD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFSD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTHFSD

Target: MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))

Alternative Name: MTHFSD (MTHFSD Products)

Synonyms: MTHFSD antibody, DKFZp469G0629 antibody, fc43c12 antibody, si:dkey-199i24.1 antibody, wu:fc43c12 antibody, zgc:153374 antibody, AW049977 antibody, BC052066 antibody, C920004D05 antibody, methenyltetrahydrofolate synthetase domain containing antibody, methenyltetrahydrofolate synthetase domain containing L homeolog antibody, MTHFSD antibody, mthfsd antibody, mthfsd.L antibody, Mthfsd antibody

Background: The function remains unknows.

Molecular Weight: 41 kDa (MW of target protein)