MIF4GD antibody (C-Term)

Catalog No. ABIN630025

Product Details anti-MIF4GD Antibody

Target: MIF4GD (MIF4G Domain Containing (MIF4GD))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MIF4GD antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MIF4 GD antibody was raised against the C terminal of MIF4 D

Purification: Purified

Immunogen: MIF4 GD antibody was raised using the C terminal of MIF4 D corresponding to a region with amino acids LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MIF4GD Blocking Peptide, catalog no. 33R-4954, is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MIF4GD

Target: MIF4GD (MIF4G Domain Containing (MIF4GD))

Alternative Name: MIF4GD (MIF4GD Products)

Synonyms: AD023 antibody, MIFD antibody, SLIP1 antibody, 1110014L05Rik antibody, 2310075G12Rik antibody, RGD1309685 antibody, MIF4GD antibody, zgc:64152 antibody, zgc:110826 antibody, ad023 antibody, mif4gd antibody, mif4gd-a antibody, mif4gd-b antibody, mifd antibody, slip1 antibody, MIF4G domain containing antibody, MIF4G domain containing a antibody, MIF4G domain containing b antibody, MIF4G domain containing L homeolog antibody, MIF4G domain containing S homeolog antibody, MIF4GD antibody, Mif4gd antibody, mif4gda antibody, mif4gdb antibody, mif4gd.L antibody, mif4gd.S antibody

Background: MIF4GD is a protein which contains an MIF4G domain.

Molecular Weight: 28 kDa (MW of target protein)