LARP7 antibody (C-Term)

Catalog No. ABIN630024

Product Details anti-LARP7 Antibody

Target: LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LARP7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LARP7 antibody was raised against the C terminal of LARP7

Purification: Purified

Immunogen: LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LARP7 Blocking Peptide, catalog no. 33R-3703, is also available for use as a blocking control in assays to test for specificity of this LARP7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LARP7

Target: LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))

Alternative Name: LARP7 (LARP7 Products)

Synonyms: ALAZS antibody, PIP7S antibody, LARP7 antibody, C330027G06Rik antibody, D3Wsu161e antibody, fa10g04 antibody, wu:fa10g04 antibody, zgc:56476 antibody, La ribonucleoprotein domain family member 7 antibody, La ribonucleoprotein domain family, member 7 antibody, la-related protein 7 antibody, La ribonucleoprotein domain family, member 7-like antibody, LARP7 antibody, Larp7 antibody, larp7 antibody, LOC100222278 antibody, LOC100627397 antibody

Background: LARP7 is a negative transcriptional regulator of polymerase II genes, acting by means of the 7SK RNP system. Within the 7SK RNP complex, the positive transcription elongation factor b (P-TEFb) is sequestered in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Chromatin Binding, SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection