LARP7 antibody (C-Term)
-
- Target See all LARP7 Antibodies
- LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LARP7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LARP7 antibody was raised against the C terminal of LARP7
- Purification
- Purified
- Immunogen
- LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL
- Top Product
- Discover our top product LARP7 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LARP7 Blocking Peptide, catalog no. 33R-3703, is also available for use as a blocking control in assays to test for specificity of this LARP7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))
- Alternative Name
- LARP7 (LARP7 Products)
- Background
- LARP7 is a negative transcriptional regulator of polymerase II genes, acting by means of the 7SK RNP system. Within the 7SK RNP complex, the positive transcription elongation factor b (P-TEFb) is sequestered in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Chromatin Binding, SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection
-