PRP6/ANT-1 antibody

Catalog No. ABIN630022

Product Details anti-PRP6/ANT-1 Antibody

Target: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRP6/ANT-1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPF6 Blocking Peptide, catalog no. 33R-7111, is also available for use as a blocking control in assays to test for specificity of this PRPF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRP6/ANT-1

Target: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Alternative Name: PRPF6 (PRPF6 Products)

Synonyms: ANT-1 antibody, ANT1 antibody, C20orf14 antibody, Prp6 antibody, SNRNP102 antibody, TOM antibody, U5-102K antibody, hPrp6 antibody, 1190003A07Rik antibody, 2610031L17Rik antibody, RGD1307103 antibody, c20orf14 antibody, fc12b02 antibody, wu:fa05f07 antibody, wu:fc12b02 antibody, zgc:65913 antibody, pre-mRNA processing factor 6 antibody, pre-mRNA splicing factor 6 antibody, PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) antibody, pre-mRNA processing factor 6 L homeolog antibody, PRPF6 antibody, Prpf6 antibody, prpf6 antibody, prpf6.L antibody

Background: PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Molecular Weight: 104 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Proton Transport, Dicarboxylic Acid Transport