PRP6/ANT-1 antibody
-
- Target See all PRP6/ANT-1 (PRPF6) Antibodies
- PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRP6/ANT-1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR
- Top Product
- Discover our top product PRPF6 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRPF6 Blocking Peptide, catalog no. 33R-3130, is also available for use as a blocking control in assays to test for specificity of this PRPF6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))
- Alternative Name
- PRPF6 (PRPF6 Products)
- Synonyms
- ANT-1 antibody, ANT1 antibody, C20orf14 antibody, Prp6 antibody, SNRNP102 antibody, TOM antibody, U5-102K antibody, hPrp6 antibody, 1190003A07Rik antibody, 2610031L17Rik antibody, RGD1307103 antibody, c20orf14 antibody, fc12b02 antibody, wu:fa05f07 antibody, wu:fc12b02 antibody, zgc:65913 antibody, pre-mRNA processing factor 6 antibody, pre-mRNA splicing factor 6 antibody, PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) antibody, pre-mRNA processing factor 6 L homeolog antibody, PRPF6 antibody, Prpf6 antibody, prpf6 antibody, prpf6.L antibody
- Background
- PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.
- Molecular Weight
- 104 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Proton Transport, Dicarboxylic Acid Transport
-