Seryl-tRNA Synthetase (SARS) (C-Term) antibody

Catalog No. ABIN630017

Product Details

Target: Seryl-tRNA Synthetase (SARS)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: SARS antibody was raised against the C terminal of SARS

Purification: Purified

Immunogen: SARS antibody was raised using the C terminal of SARS corresponding to a region with amino acids PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SARS Blocking Peptide, catalog no. 33R-7048, is also available for use as a blocking control in assays to test for specificity of this SARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Seryl-tRNA Synthetase (SARS)

Alternative Name: SARS (SARS Products)

Synonyms: SERRS antibody, SERS antibody, Sars1 antibody, Strs antibody, serRS antibody, SerRS antibody, wu:fk51f08 antibody, zgc:92152 antibody, seryl-tRNA synthetase antibody, seryl-aminoacyl-tRNA synthetase antibody, SARS antibody, Sars antibody, sars antibody

Background: SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Molecular Weight: 57 kDa (MW of target protein)