RPLP0 antibody (Middle Region)

Catalog No. ABIN630015

Product Details anti-RPLP0 Antibody

Target: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPLP0 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPLP0 antibody was raised against the middle region of RPLP0

Purification: Purified

Immunogen: RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPLP0 Blocking Peptide, catalog no. 33R-7085, is also available for use as a blocking control in assays to test for specificity of this RPLP0 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPLP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPLP0

Target: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Alternative Name: RPLP0 (RPLP0 Products)

Synonyms: AP3 antibody, Ap3 antibody, Ape antibody, CG7490 antibody, Dmel\\CG7490 antibody, LP0 antibody, P0 antibody, P35 antibody, PO antibody, RLA0 antibody, RPL P0 antibody, RpP0 antibody, RpPO antibody, Rplp0 antibody, l(3)0154 antibody, l(3)01544 antibody, p0 antibody, RPLP0 antibody, arp antibody, fa56b12 antibody, fb04a12 antibody, wu:fa56b12 antibody, wu:fb15a08 antibody, wu:fk48c12 antibody, arbp antibody, l10e antibody, lp0 antibody, prlp0 antibody, rpp0 antibody, L10E antibody, PRLP0 antibody, RPP0 antibody, 36B4 antibody, Arbp antibody, ARBP antibody, Ribosomal protein LP0 antibody, ribosomal protein lateral stalk subunit P0 antibody, ribosomal protein, large, P0 antibody, ribosomal protein, large, P0 S homeolog antibody, RpLP0 antibody, RPLP0 antibody, rplp0 antibody, rplp0.S antibody, Rplp0 antibody

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2.

Molecular Weight: 35 kDa (MW of target protein)