RPL9 antibody (C-Term)

Catalog No. ABIN630013

Product Details anti-RPL9 Antibody

Target: RPL9 (Ribosomal Protein L9 (RPL9))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPL9 antibody was raised against the C terminal of RPL9

Purification: Purified

Immunogen: RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIY

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL9 Blocking Peptide, catalog no. 33R-3626, is also available for use as a blocking control in assays to test for specificity of this RPL9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL9

Target: RPL9 (Ribosomal Protein L9 (RPL9))

Alternative Name: RPL9 (RPL9 Products)

Synonyms: CG6141 antibody, Dmel\\CG6141 antibody, L9 antibody, M(2)32D antibody, Rp L9 antibody, Rpl9 antibody, anon-EST:fe3A6 antibody, anon-WO0153538.25 antibody, anon-WO0153538.26 antibody, anon-WO0153538.27 antibody, rpL9 antibody, ab02c03 antibody, fa93a01 antibody, mg:ab02c03 antibody, wu:fa93a01 antibody, zgc:103730 antibody, NPC-A-16 antibody, Ribosomal protein L9 antibody, 60S ribosomal protein L9 antibody, ribosomal protein L9 antibody, ribosomal protein L9 L homeolog antibody, RpL9 antibody, rpl-9 antibody, rpl9 antibody, rpl9.L antibody, RPL9 antibody, Rpl9 antibody

Background: RPL9 is a ribosomal protein that is a component of the 60S subunit. RPL9 belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 21 kDa (MW of target protein)