LSM2 antibody

Catalog No. ABIN630011

Product Details anti-LSM2 Antibody

Target: LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LSM2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: LSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LSM2 Blocking Peptide, catalog no. 33R-9016, is also available for use as a blocking control in assays to test for specificity of this LSM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LSM2

Target: LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))

Alternative Name: LSM2 (LSM2 Products)

Synonyms: LSM2 antibody, 61.t00040 antibody, 18.m06211 antibody, 18.m06235 antibody, lsm2 antibody, C6orf28 antibody, G7B antibody, YBL026W antibody, snRNP antibody, D17H6S56E-2 antibody, D17H6S56E2 antibody, Dmapl antibody, Dmpkap antibody, G7b antibody, Sm-X5 antibody, SmX5 antibody, wu:fe48h10 antibody, zgc:101795 antibody, LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated antibody, U6 snRNA-associated sm-like protein Lsm2, putative antibody, u6 snRNA-associated sm-like protein lsm2 antibody, U6 snRNA-associated Sm-like protein LSm2 antibody, U6 snRNA-associated Sm-like protein LSm2, putative antibody, u6 snRNA-associated sm-like protein Lsm2 antibody, U6 snRNA-associated sm-like protein Lsm2,putative antibody, u6 snRNA-associated sm-like protein lsm2, putative antibody, LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog antibody, smx5 antibody, LSM2 antibody, PFE1020w antibody, CNC01770 antibody, EHI_068580 antibody, PCHAS_123570 antibody, BBOV_II002620 antibody, BBOV_II002860 antibody, EBI_26471 antibody, Bm1_23515 antibody, PKH_101210 antibody, CGB_C2600W antibody, lsm2 antibody, lsm2.S antibody, Lsm2 antibody, smx5 antibody

Background: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molecular Weight: 10 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization