LSM2 antibody
-
- Target See all LSM2 Antibodies
- LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LSM2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- LSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
- Top Product
- Discover our top product LSM2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LSM2 Blocking Peptide, catalog no. 33R-9016, is also available for use as a blocking control in assays to test for specificity of this LSM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))
- Alternative Name
- LSM2 (LSM2 Products)
- Background
- Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
- Molecular Weight
- 10 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-