SNRNP35 antibody (N-Term)
-
- Target See all SNRNP35 Antibodies
- SNRNP35 (U11/U12 SnRNP 35 KDa Protein)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SNRNP35 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- U1 SNRNPBP antibody was raised against the N terminal of U1 NRNPBP
- Purification
- Purified
- Immunogen
- U1 SNRNPBP antibody was raised using the N terminal of U1 NRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR
- Top Product
- Discover our top product SNRNP35 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
U1SNRNPBP Blocking Peptide, catalog no. 33R-7830, is also available for use as a blocking control in assays to test for specificity of this U1SNRNPBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of U0 NRNPBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNRNP35 (U11/U12 SnRNP 35 KDa Protein)
- Alternative Name
- U1SNRNPBP (SNRNP35 Products)
- Background
- U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors.
- Molecular Weight
- 28 kDa (MW of target protein)
-