PPIE antibody

Catalog No. ABIN630008

Product Details anti-PPIE Antibody

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIE antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIE Blocking Peptide, catalog no. 33R-4462, is also available for use as a blocking control in assays to test for specificity of this PPIE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIE

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Alternative Name: PPIE (PPIE Products)

Synonyms: zgc:112471 antibody, CG4886 antibody, CYP33 antibody, Cyp33 antibody, Dcyp33 antibody, Dmel\\CG4886 antibody, PPIE antibody, cyp-33 antibody, cyp33 antibody, cype antibody, CYP-33 antibody, 2010010D16Rik antibody, Ab1-210 antibody, peptidylprolyl isomerase E (cyclophilin E) antibody, cyclophilin-33 antibody, peptidylprolyl isomerase E antibody, peptidylprolyl isomerase E (cyclophilin E) L homeolog antibody, ppie antibody, cyp33 antibody, PPIE antibody, ppie.L antibody, Ppie antibody

Background: PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain.

Molecular Weight: 33 kDa (MW of target protein)