PPIE antibody
-
- Target See all PPIE Antibodies
- PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPIE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
- Top Product
- Discover our top product PPIE Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPIE Blocking Peptide, catalog no. 33R-7968, is also available for use as a blocking control in assays to test for specificity of this PPIE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))
- Alternative Name
- PPIE (PPIE Products)
- Synonyms
- zgc:112471 antibody, CG4886 antibody, CYP33 antibody, Cyp33 antibody, Dcyp33 antibody, Dmel\\CG4886 antibody, PPIE antibody, cyp-33 antibody, cyp33 antibody, cype antibody, CYP-33 antibody, 2010010D16Rik antibody, Ab1-210 antibody, peptidylprolyl isomerase E (cyclophilin E) antibody, cyclophilin-33 antibody, peptidylprolyl isomerase E antibody, peptidylprolyl isomerase E (cyclophilin E) L homeolog antibody, ppie antibody, cyp33 antibody, PPIE antibody, ppie.L antibody, Ppie antibody
- Background
- PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain.
- Molecular Weight
- 26 kDa (MW of target protein)
-