STAU1/Staufen antibody
-
- Target See all STAU1/Staufen (STAU1) Antibodies
- STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STAU1/Staufen antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN
- Top Product
- Discover our top product STAU1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STAU1 Blocking Peptide, catalog no. 33R-5465, is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))
- Alternative Name
- STAU1 (STAU1 Products)
- Synonyms
- STAU1 antibody, DKFZp459A0124 antibody, CG5753 antibody, Dmel\\CG5753 antibody, Dmstau antibody, STAU antibody, Stau antibody, Stauf antibody, dStau antibody, stau antibody, XStau antibody, XStau1 antibody, Staufen antibody, Staufen1 antibody, MGC145034 antibody, 5830401L18Rik antibody, AW549911 antibody, C85792 antibody, fi67e05 antibody, wu:fi67e05 antibody, zgc:77271 antibody, staufen double-stranded RNA binding protein 1 antibody, staufen antibody, RNA binding protein homolog antibody, staufen (RNA binding protein) homolog 1 (Drosophila) antibody, staufen double-stranded RNA binding protein 1 L homeolog antibody, STAU1 antibody, stau antibody, stau1 antibody, STAUFEN antibody, Stau1 antibody, stau1.L antibody
- Background
- STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures.
- Molecular Weight
- 63 kDa (MW of target protein)
- Pathways
- Asymmetric Protein Localization
-