SNRNP70 antibody
-
- Target See all SNRNP70 Antibodies
- SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SNRNP70 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK
- Top Product
- Discover our top product SNRNP70 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SNRP70 Blocking Peptide, catalog no. 33R-10176, is also available for use as a blocking control in assays to test for specificity of this SNRP70 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRP70 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))
- Alternative Name
- SNRP70 (SNRNP70 Products)
- Synonyms
- rnpu1z antibody, rpu1 antibody, snrp70 antibody, u170k antibody, u1ap antibody, u1rnp antibody, SNRP70 antibody, wu:fc20b04 antibody, zgc:136450 antibody, 2700022N21Rik antibody, 3200002N22Rik antibody, 70kDa antibody, AI325098 antibody, R74807 antibody, Rnulp70 antibody, Snrp70 antibody, Srnp70 antibody, U1-70 antibody, U1-70K antibody, RNPU1Z antibody, RPU1 antibody, Snp1 antibody, U170K antibody, U1AP antibody, U1RNP antibody, small nuclear ribonucleoprotein, U1 70kDa subunit antibody, small nuclear ribonucleoprotein U1 subunit 70 antibody, small nuclear ribonucleoprotein 70 (U1) antibody, small nuclear ribonucleoprotein, U1 70kDa subunit L homeolog antibody, snrnp70 antibody, SNRNP70 antibody, Snrnp70 antibody, snrnp70.L antibody
- Background
- SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.
- Molecular Weight
- 48 kDa (MW of target protein)
-