SNRNP70 antibody

Catalog No. ABIN630004

Product Details anti-SNRNP70 Antibody

Target: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRNP70 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRP70 Blocking Peptide, catalog no. 33R-10176, is also available for use as a blocking control in assays to test for specificity of this SNRP70 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRP70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRNP70

Target: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Alternative Name: SNRP70 (SNRNP70 Products)

Synonyms: rnpu1z antibody, rpu1 antibody, snrp70 antibody, u170k antibody, u1ap antibody, u1rnp antibody, SNRP70 antibody, wu:fc20b04 antibody, zgc:136450 antibody, 2700022N21Rik antibody, 3200002N22Rik antibody, 70kDa antibody, AI325098 antibody, R74807 antibody, Rnulp70 antibody, Snrp70 antibody, Srnp70 antibody, U1-70 antibody, U1-70K antibody, RNPU1Z antibody, RPU1 antibody, Snp1 antibody, U170K antibody, U1AP antibody, U1RNP antibody, small nuclear ribonucleoprotein, U1 70kDa subunit antibody, small nuclear ribonucleoprotein U1 subunit 70 antibody, small nuclear ribonucleoprotein 70 (U1) antibody, small nuclear ribonucleoprotein, U1 70kDa subunit L homeolog antibody, snrnp70 antibody, SNRNP70 antibody, Snrnp70 antibody, snrnp70.L antibody

Background: SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.

Molecular Weight: 48 kDa (MW of target protein)