SNRNP70 antibody
-
- Target See all SNRNP70 Antibodies
- SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SNRNP70 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK
- Top Product
- Discover our top product SNRNP70 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SNRP70 Blocking Peptide, catalog no. 33R-10176, is also available for use as a blocking control in assays to test for specificity of this SNRP70 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRP70 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))
- Alternative Name
- SNRP70 (SNRNP70 Products)
- Background
- SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.
- Molecular Weight
- 48 kDa (MW of target protein)
-