RPL8 antibody (C-Term)

Catalog No. ABIN630002

Product Details anti-RPL8 Antibody

Target: RPL8 (Ribosomal Protein L8 (RPL8))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RPL8 antibody was raised against the C terminal of RPL8

Purification: Purified

Immunogen: RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM

Application Details

Application Notes: WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL8 Blocking Peptide, catalog no. 33R-4496, is also available for use as a blocking control in assays to test for specificity of this RPL8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL8

Target: RPL8 (Ribosomal Protein L8 (RPL8))

Alternative Name: RPL8 (RPL8 Products)

Synonyms: L8 antibody, zgc:73105 antibody, zgc:77641 antibody, CG1263 antibody, Dmel\\CG1263 antibody, M(3)62F antibody, M(3)LS2 antibody, Rp L8 antibody, anon-EST:Posey5 antibody, rpL8 antibody, RPL8 antibody, ribosomal protein L8 antibody, ribosomal protein L8 S homeolog antibody, Ribosomal protein L8 antibody, microRNA 6850 antibody, RPL8 antibody, Rpl8 antibody, rpl8.S antibody, rpl8 antibody, RpL8 antibody, MIR6850 antibody

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL8 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Regulation of Cell Size