APOBEC2 antibody (N-Term)
-
- Target See all APOBEC2 Antibodies
- APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APOBEC2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ApoBEC2 antibody was raised against the N terminal of APOBEC2
- Purification
- Purified
- Immunogen
- ApoBEC2 antibody was raised using the N terminal of APOBEC2 corresponding to a region with amino acids VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
- Top Product
- Discover our top product APOBEC2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ApoBEC2 Blocking Peptide, catalog no. 33R-9438, is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))
- Alternative Name
- ApoBEC2 (APOBEC2 Products)
- Synonyms
- MGC84761 antibody, arp1 antibody, arcd1 antibody, MGC89256 antibody, APOBEC2 antibody, DKFZp468H1727 antibody, Arp1 antibody, ARCD1 antibody, ARP1 antibody, apolipoprotein B mRNA editing enzyme catalytic subunit 2 antibody, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 L homeolog antibody, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 antibody, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2 antibody, APOBEC2 antibody, apobec2.L antibody, apobec2 antibody, Apobec2 antibody
- Background
- APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
- Molecular Weight
- 25 kDa (MW of target protein)
-