SFRS8 antibody (N-Term)

Catalog No. ABIN629997

Product Details anti-SFRS8 Antibody

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRS8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SFRS8 antibody was raised against the N terminal of SFRS8

Purification: Purified

Immunogen: SFRS8 antibody was raised using the N terminal of SFRS8 corresponding to a region with amino acids MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS8 Blocking Peptide, catalog no. 33R-6624, is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRS8

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Alternative Name: SFRS8 (SFSWAP Products)

Synonyms: SFRS8 antibody, SWAP antibody, 1190005N23Rik antibody, 6330437E22Rik antibody, AI197402 antibody, AW212079 antibody, Sfrs8 antibody, Srsf8 antibody, splicing factor SWAP antibody, splicing factor, suppressor of white-apricot homolog (Drosophila) antibody, splicing factor SWAP homolog antibody, SFSWAP antibody, Sfswap antibody

Background: SFRS8 is a human homolog of Drosophila splicing regulatory protein.

Molecular Weight: 105 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization