SFRS8 antibody (N-Term)
-
- Target See all SFRS8 (SFSWAP) Antibodies
- SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SFRS8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SFRS8 antibody was raised against the N terminal of SFRS8
- Purification
- Purified
- Immunogen
- SFRS8 antibody was raised using the N terminal of SFRS8 corresponding to a region with amino acids MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER
- Top Product
- Discover our top product SFSWAP Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFRS8 Blocking Peptide, catalog no. 33R-6624, is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))
- Alternative Name
- SFRS8 (SFSWAP Products)
- Background
- SFRS8 is a human homolog of Drosophila splicing regulatory protein.
- Molecular Weight
- 105 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-