SNRPF antibody (N-Term)

Catalog No. ABIN629996

Product Details anti-SNRPF Antibody

Target: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPF antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SNRPF antibody was raised against the N terminal of SNRPF

Purification: Purified

Immunogen: SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY

Application Details

Application Notes: WB: 0.31 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPF Blocking Peptide, catalog no. 33R-6466, is also available for use as a blocking control in assays to test for specificity of this SNRPF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPF

Target: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Alternative Name: SNRPF (SNRPF Products)

Synonyms: BcDNA:GM23968 antibody, CG16792 antibody, Deb antibody, Deb-B antibody, DebB antibody, Dmel\\CG16792 antibody, dF antibody, deb-b antibody, snRNP-F antibody, sm-f antibody, smf antibody, snrpfl antibody, SMF antibody, Sm-F antibody, SmF antibody, 2010013O18Rik antibody, sm-F antibody, Small ribonucleoprotein particle protein SmF antibody, small nuclear ribonucleoprotein polypeptide F antibody, small nuclear ribonucleoprotein polypeptide F S homeolog antibody, SmF antibody, SNRPF antibody, snrpf antibody, Snrpf antibody, snrpf.S antibody

Background: SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.

Molecular Weight: 9 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization