PUF60 antibody (C-Term)

Catalog No. ABIN629984

Product Details anti-PUF60 Antibody

Target: PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PUF60 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PUF60 antibody was raised against the C terminal of PUF60

Purification: Purified

Immunogen: PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PUF60 Blocking Peptide, catalog no. 33R-7261, is also available for use as a blocking control in assays to test for specificity of this PUF60 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUF60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PUF60

Target: PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))

Alternative Name: PUF60 (PUF60 Products)

Synonyms: FIR antibody, RoBPI antibody, SIAHBP1 antibody, fc21a05 antibody, wu:fc21a05 antibody, wu:fi43a08 antibody, 2410104I19Rik antibody, 2810454F19Rik antibody, Siahbp1 antibody, fe37c05 antibody, repressor antibody, si:ch211-12p8.2 antibody, si:zc12p8.2 antibody, wu:fb33e11 antibody, wu:fe37c05 antibody, zgc:86806 antibody, poly(U) binding splicing factor 60 antibody, poly-U binding splicing factor a antibody, poly-U binding splicing factor 60 antibody, poly-U binding splicing factor b antibody, PUF60 antibody, puf60a antibody, Puf60 antibody, puf60b antibody

Background: PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.

Molecular Weight: 58 kDa (MW of target protein)