SRP14 antibody

Catalog No. ABIN629979

Product Details anti-SRP14 Antibody

Target: SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRP14 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SRP14 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRP14 Blocking Peptide, catalog no. 33R-4587, is also available for use as a blocking control in assays to test for specificity of this SRP14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRP14

Target: SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))

Alternative Name: SRP14 (SRP14 Products)

Synonyms: zgc:112290 antibody, 14kDa antibody, AW536328 antibody, ALURBP antibody, signal recognition particle 14 antibody, signal recognition particle 14kDa S homeolog antibody, srp14 antibody, Srp14 antibody, srp14.S antibody, SRP14 antibody

Background: SRP14 belongs to the SRP14 family. The signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.

Molecular Weight: 15 kDa (MW of target protein)