PTBP2 antibody (N-Term)

Catalog No. ABIN629977

Product Details anti-PTBP2 Antibody

Target: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTBP2 antibody was raised against the N terminal of PTBP2

Purification: Purified

Immunogen: PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTBP2 Blocking Peptide, catalog no. 33R-5835, is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTBP2

Target: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Alternative Name: PTBP2 (PTBP2 Products)

Synonyms: PTB antibody, PTBLP antibody, brPTB antibody, nPTB antibody, nPTB5 antibody, nPTB6 antibody, nPTB7 antibody, nPTB8 antibody, Ptb2 antibody, PTBP2 antibody, im:7153495 antibody, ptbp2 antibody, si:ch211-160l17.2 antibody, wu:fa08f05 antibody, wu:fc05d10 antibody, zgc:113074 antibody, polypyrimidine tract binding protein 2 antibody, polypyrimidine tract binding protein 2b antibody, polypyrimidine tract binding protein 2a antibody, PTBP2 antibody, Ptbp2 antibody, ptbp2b antibody, ptbp2a antibody

Background: PTBP2 binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interactome