EIF3G antibody (N-Term)

Catalog No. ABIN629975

Product Details anti-EIF3G Antibody

Target: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF3G antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: EIF3 S4 antibody was raised against the N terminal of EIF3 4

Purification: Purified

Immunogen: EIF3 S4 antibody was raised using the N terminal of EIF3 4 corresponding to a region with amino acids SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF3S4 Blocking Peptide, catalog no. 33R-8672, is also available for use as a blocking control in assays to test for specificity of this EIF3S4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF3G

Target: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Alternative Name: EIF3S4 (EIF3G Products)

Background: EIF3S4 contains 1 RRM (RNA recognition motif) domain. It binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization