DDX6 antibody
-
- Target See all DDX6 Antibodies
- DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDX6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- DDX6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ
- Top Product
- Discover our top product DDX6 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX6 Blocking Peptide, catalog no. 33R-4684, is also available for use as a blocking control in assays to test for specificity of this DDX6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))
- Alternative Name
- DDX6 (DDX6 Products)
- Background
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX6 encodes a DEAD box protein. It may contribute to the cell proliferation and carcinogenesis.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-