CELF2 antibody (N-Term)

Catalog No. ABIN629968

Product Details anti-CELF2 Antibody

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CELF2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CUGBP2 antibody was raised against the N terminal of CUGBP2

Purification: Purified

Immunogen: CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CUGBP2 Blocking Peptide, catalog no. 33R-9924, is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CELF2

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Alternative Name: CUGBP2 (CELF2 Products)

Synonyms: CUGBP2 antibody, BRUNOL3 antibody, ETR-3 antibody, ETR3 antibody, NAPOR antibody, B230218O03 antibody, B230345P09Rik antibody, C88023 antibody, CELF-2 antibody, CUG-BP2 antibody, Cugbp2 antibody, D230046B21Rik antibody, Etr-3 antibody, Napor antibody, Napor-2 antibody, mETR-3 antibody, cb906 antibody, cugbp2 antibody, fj87b07 antibody, wu:fj87b07 antibody, brunol3 antibody, celf2 antibody, cugbp2-a antibody, etr3 antibody, napor antibody, Brunol3 antibody, Etr3 antibody, CUGBP Elav-like family member 2 antibody, CUGBP, Elav-like family member 2 antibody, cugbp, Elav-like family member 2 antibody, CUGBP, Elav-like family member 2 L homeolog antibody, CELF2 antibody, Celf2 antibody, celf2 antibody, celf2.L antibody

Background: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization