MSI2 antibody

Catalog No. ABIN629967

Product Details anti-MSI2 Antibody

Target: MSI2 (Musashi Homolog 2 (MSI2))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSI2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MSI2 Blocking Peptide, catalog no. 33R-5352, is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MSI2

Target: MSI2 (Musashi Homolog 2 (MSI2))

Alternative Name: MSI2 (MSI2 Products)

Synonyms: MSI2H antibody, 1700105C15Rik antibody, AI451722 antibody, AI563628 antibody, AW489193 antibody, Msi2h antibody, RGD1560397 antibody, MSI2 antibody, musashi-2 antibody, musashi2 antibody, xrp1 antibody, msi2 antibody, zgc:174035 antibody, zgc:63812 antibody, cb746 antibody, fi47b09 antibody, wu:fb02d08 antibody, wu:fi32d12 antibody, wu:fi47b09 antibody, musashi RNA binding protein 2 antibody, musashi RNA-binding protein 2 antibody, musashi RNA binding protein 2 S homeolog antibody, musashi RNA-binding protein 2b antibody, musashi RNA-binding protein 2a antibody, MSI2 antibody, Msi2 antibody, msi2.S antibody, msi2 antibody, msi2b antibody, msi2a antibody

Background: MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.

Molecular Weight: 36 kDa (MW of target protein)