MATR3 antibody (N-Term)

Catalog No. ABIN629962

Product Details anti-MATR3 Antibody

Target: MATR3 (Matrin 3 (MATR3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MATR3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Matrin 3 antibody was raised against the N terminal of MATR3

Purification: Purified

Immunogen: Matrin 3 antibody was raised using the N terminal of MATR3 corresponding to a region with amino acids MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Matrin 3 Blocking Peptide, catalog no. 33R-6456, is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MATR3

Target: MATR3 (Matrin 3 (MATR3))

Alternative Name: Matrin 3 (MATR3 Products)

Synonyms: MPD2 antibody, VCPDM antibody, 1110061A14Rik antibody, 2810017I02Rik antibody, AI841759 antibody, AW555618 antibody, D030046F20Rik antibody, mKIAA0723 antibody, P130/MAT3 antibody, matrin-3 antibody, matr3 antibody, MGC79524 antibody, MATR3 antibody, DKFZp459A057 antibody, DKFZp459A162 antibody, DKFZp459F0515 antibody, DKFZp469A1933 antibody, LOC100232255 antibody, KIAA0723 antibody, matrin 3 antibody, matrin 3 S homeolog antibody, MATR3 antibody, Matr3 antibody, matr3.S antibody, matr3 antibody

Background: MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.

Molecular Weight: 93 kDa (MW of target protein)