DDX19B antibody

Catalog No. ABIN629961

Product Details anti-DDX19B Antibody

Target: DDX19B (DEAD (Asp-Glu-Ala-As) Box Polypeptide 19B (DDX19B))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX19B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX19 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX19B Blocking Peptide, catalog no. 33R-3358, is also available for use as a blocking control in assays to test for specificity of this DDX19B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX19B

Target: DDX19B (DEAD (Asp-Glu-Ala-As) Box Polypeptide 19B (DDX19B))

Alternative Name: DDX19B (DDX19B Products)

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX19B is a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities.

Molecular Weight: 53 kDa (MW of target protein)