DDX46 antibody

Catalog No. ABIN629960

Product Details anti-DDX46 Antibody

Target: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX46 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX46 Blocking Peptide, catalog no. 33R-3247, is also available for use as a blocking control in assays to test for specificity of this DDX46 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX46

Target: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Alternative Name: DDX46 (DDX46 Products)

Background: DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex, it plays an important role in pre-mRNA splicing.

Molecular Weight: 113 kDa (MW of target protein)