EIF4A3 antibody
-
- Target See all EIF4A3 Antibodies
- EIF4A3 (Eukaryotic Translation Initiation Factor 4A3 (EIF4A3))
-
Reactivity
- Human, Mouse, Rat, Zebrafish (Danio rerio), Dog, C. elegans
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF4A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- DDX48 antibody was raised using a synthetic peptide corresponding to a region with amino acids QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV
- Top Product
- Discover our top product EIF4A3 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX48 Blocking Peptide, catalog no. 33R-7488, is also available for use as a blocking control in assays to test for specificity of this DDX48 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX48 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF4A3 (Eukaryotic Translation Initiation Factor 4A3 (EIF4A3))
- Alternative Name
- DDX48 (EIF4A3 Products)
- Synonyms
- DDX48 antibody, NMP265 antibody, NUK34 antibody, eIF4AIII antibody, 2400003O03Rik antibody, Ddx48 antibody, eIF4A-III antibody, mKIAA0111 antibody, ddx48 antibody, nuk34 antibody, nmp265 antibody, eif4aiii antibody, EIF4A3 antibody, eif4a3 antibody, zgc:56139 antibody, XeIF-4AIII antibody, eif4a3-B antibody, eukaryotic translation initiation factor 4A3 antibody, eukaryotic initiation factor 4A-III antibody, eukaryotic translation initiation factor 4A3 S homeolog antibody, Eukaryotic initiation factor 4A-III antibody, EIF4A3 antibody, Eif4a3 antibody, eif4a3 antibody, LOC100185906 antibody, eif4a3.S antibody, if4a3 antibody
- Background
- DDX48 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.
- Molecular Weight
- 45 kDa (MW of target protein)
-