DDX47 antibody

Catalog No. ABIN629954

Product Details anti-DDX47 Antibody

Target: DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX47 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETP

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX47 Blocking Peptide, catalog no. 33R-7625, is also available for use as a blocking control in assays to test for specificity of this DDX47 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX47

Target: DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))

Alternative Name: DDX47 (DDX47 Products)

Synonyms: ddx47 antibody, DDX47 antibody, E4-DBP antibody, HQ0256 antibody, MSTP162 antibody, RRP3 antibody, 4930588A18Rik antibody, C77285 antibody, DEAD-box helicase 47 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 antibody, DEAD-box helicase 47 L homeolog antibody, DDX47 antibody, ddx47 antibody, Ddx47 antibody, ddx47.L antibody

Background: DDX47 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molecular Weight: 50 kDa (MW of target protein)