DDX55 antibody

Catalog No. ABIN629953

Product Details anti-DDX55 Antibody

Target: DDX55 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 55 (DDX55))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX55 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX55 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX55 Blocking Peptide, catalog no. 33R-3374, is also available for use as a blocking control in assays to test for specificity of this DDX55 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX55

Target: DDX55 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 55 (DDX55))

Alternative Name: DDX55 (DDX55 Products)

Synonyms: 2810021H22Rik antibody, mKIAA1595 antibody, chunp6861 antibody, fc32a12 antibody, kiaa1595 antibody, wu:fc32a12 antibody, ddx55 antibody, MGC78784 antibody, DDX55 antibody, DEAD-box helicase 55 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 antibody, DEAD-box helicase 55 S homeolog antibody, DDX55 antibody, Ddx55 antibody, ddx55 antibody, ddx55.S antibody

Background: Anti-DDX55 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Multiple alternatively spliced transcript variants have been found for Anti-DDX55, but the biological validity of only one transcript has been confirmed.

Molecular Weight: 66 kDa (MW of target protein)