PCBP2 antibody

Catalog No. ABIN629951

Product Details anti-PCBP2 Antibody

Target: PCBP2 (Poly(rC) Binding Protein 2 (PCBP2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCBP2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCBP2 Blocking Peptide, catalog no. 33R-9591, is also available for use as a blocking control in assays to test for specificity of this PCBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCBP2

Target: PCBP2 (Poly(rC) Binding Protein 2 (PCBP2))

Alternative Name: PCBP2 (PCBP2 Products)

Synonyms: HNRNPE2 antibody, HNRPE2 antibody, hnRNP-E2 antibody, AW412548 antibody, Hnrpx antibody, alphaCP-2 antibody, PCBP3 antibody, fb36h02 antibody, wu:fb36h02 antibody, zgc:55964 antibody, PCBP2 antibody, poly(rC) binding protein 2 antibody, poly(rC) binding protein 2 L homeolog antibody, PCBP2 antibody, Pcbp2 antibody, pcbp2 antibody, pcbp2.L antibody

Background: PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.

Molecular Weight: 40 kDa (MW of target protein)