GRSF1 antibody (N-Term)

Catalog No. ABIN629949

Product Details anti-GRSF1 Antibody

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRSF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GRSF1 antibody was raised against the N terminal of GRSF1

Purification: Purified

Immunogen: GRSF1 antibody was raised using the N terminal of GRSF1 corresponding to a region with amino acids SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRSF1 Blocking Peptide, catalog no. 33R-8338, is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRSF1

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Alternative Name: GRSF1 (GRSF1 Products)

Synonyms: GRSF1 antibody, wu:fb62c04 antibody, zgc:153305 antibody, MGC186196 antibody, B130010H02 antibody, BB232551 antibody, C80280 antibody, D5Wsu31e antibody, G-rich RNA sequence binding factor 1 antibody, G-rich RNA sequence binding factor 1 S homeolog antibody, GRSF1 antibody, grsf1 antibody, grsf1.S antibody, Grsf1 antibody

Background: GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.

Molecular Weight: 47 kDa (MW of target protein)