PAIP1 antibody

Catalog No. ABIN629948

Product Details anti-PAIP1 Antibody

Target: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAIP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAIP1 Blocking Peptide, catalog no. 33R-2650, is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAIP1

Target: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Alternative Name: PAIP1 (PAIP1 Products)

Synonyms: fb53g01 antibody, zgc:91954 antibody, wu:fb53g01 antibody, poly(A) binding protein interacting protein 1 antibody, polyadenylate binding protein-interacting protein 1 antibody, poly(A) binding protein interacting protein 1 S homeolog antibody, PAIP1 antibody, paip1 antibody, Paip1 antibody, paip1.S antibody

Background: PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.

Molecular Weight: 44 kDa (MW of target protein)