TROVE2 antibody (N-Term)
-
- Target See all TROVE2 Antibodies
- TROVE2 (TROVE Domain Family, Member 2 (TROVE2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TROVE2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- TROVE2 antibody was raised against the N terminal of TROVE2
- Purification
- Purified
- Immunogen
- TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS
- Top Product
- Discover our top product TROVE2 Primary Antibody
-
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 3-535) antibody
TROVE2 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 1-100) antibodyTROVE2 Reactivity: Human WB, ELISA, IF Host: Mouse Monoclonal 1F2 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (Center) antibodyTROVE2 Reactivity: Human, Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (N-Term) antibodyTROVE2 Reactivity: Human WB, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 51-100) antibodyTROVE2 Reactivity: Human, Horse, Pig WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 1-538) antibodyTROVE2 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 2E10 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) antibodyTROVE2 Reactivity: Human WB, ELISA, IHC, IHC (p) Host: Mouse Monoclonal 2B4 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 20-69) antibodyTROVE2 Reactivity: Human, Mouse, Dog, Guinea Pig, Rabbit, Monkey, Bat WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (N-Term) antibodyTROVE2 Reactivity: Human, Mouse, Dog WB, IHC Host: Rabbit Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 467-495), (C-Term) antibodyTROVE2 Reactivity: Human WB Host: Rabbit Polyclonal RB36981 unconjugated
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TROVE2 Blocking Peptide, catalog no. 33R-7607, is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TROVE2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TROVE2 (TROVE Domain Family, Member 2 (TROVE2))
- Alternative Name
- TROVE2 (TROVE2 Products)
- Synonyms
- SSA2 antibody, TROVE2 antibody, ssa2 antibody, ssa2-A antibody, RO60 antibody, RORNP antibody, 1810007I17Rik antibody, A530054J02Rik antibody, AI646302 antibody, SS-A/Ro antibody, Ssa antibody, Ssa2 antibody, TROVE domain family member 2 antibody, TROVE domain family, member 2 antibody, TROVE domain family member 2 L homeolog antibody, TROVE2 antibody, trove2 antibody, trove2.L antibody, Trove2 antibody
- Background
- As a RNA-binding protein, TROVE2 binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.
- Molecular Weight
- 58 kDa (MW of target protein)
-
