NOVA2 antibody (Middle Region)
-
- Target See all NOVA2 Antibodies
- NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NOVA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NOVA2 antibody was raised against the middle region of NOVA2
- Purification
- Purified
- Immunogen
- NOVA2 antibody was raised using the middle region of NOVA2 corresponding to a region with amino acids EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP
- Top Product
- Discover our top product NOVA2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NOVA2 Blocking Peptide, catalog no. 33R-2631, is also available for use as a blocking control in assays to test for specificity of this NOVA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))
- Alternative Name
- NOVA2 (NOVA2 Products)
- Background
- NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.
- Molecular Weight
- 54 kDa (MW of target protein)
-