DDX50 antibody

Catalog No. ABIN629940

Product Details anti-DDX50 Antibody

Target: DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX50 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX50 Blocking Peptide, catalog no. 33R-2388, is also available for use as a blocking control in assays to test for specificity of this DDX50 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX50

Target: DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))

Alternative Name: DDX50 (DDX50 Products)

Synonyms: GU2 antibody, GUB antibody, RH-II/GuB antibody, mcdrh antibody, 4933429B04Rik antibody, 8430408E17Rik antibody, RH-II antibody, DDX50 antibody, DDX21 antibody, DExD-box helicase 50 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 antibody, DExD-box helicase 21 antibody, DDX50 antibody, Ddx50 antibody, DDX21 antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molecular Weight: 81 kDa (MW of target protein)