NXF3 antibody (C-Term)
-
- Target See all NXF3 Antibodies
- NXF3 (Nuclear RNA Export Factor 3 (NXF3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NXF3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- NXF3 antibody was raised against the C terminal of NXF3
- Purification
- Purified
- Immunogen
- NXF3 antibody was raised using the C terminal of NXF3 corresponding to a region with amino acids SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS
- Top Product
- Discover our top product NXF3 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NXF3 Blocking Peptide, catalog no. 33R-8801, is also available for use as a blocking control in assays to test for specificity of this NXF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NXF3 (Nuclear RNA Export Factor 3 (NXF3))
- Alternative Name
- NXF3 (NXF3 Products)
- Background
- NXF3 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF3 has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.
- Molecular Weight
- 58 kDa (MW of target protein)
-