CPEB2 antibody (Middle Region)

Catalog No. ABIN629930

Product Details anti-CPEB2 Antibody

Target: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPEB2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CPEB2 antibody was raised against the middle region of CPEB2

Purification: Purified

Immunogen: CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPEB2 Blocking Peptide, catalog no. 33R-2191, is also available for use as a blocking control in assays to test for specificity of this CPEB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPEB2

Target: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Alternative Name: CPEB2 (CPEB2 Products)

Synonyms: CPE-BP2 antibody, CPEB-2 antibody, hCPEB-2 antibody, A630055H10Rik antibody, Cpe-bp2 antibody, CPEB2 antibody, DKFZp469M211 antibody, cytoplasmic polyadenylation element binding protein 2 antibody, cytoplasmic polyadenylation element-binding protein 2 antibody, CPEB2 antibody, Cpeb2 antibody, cpeb2 antibody, LOC100351062 antibody

Background: CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Molecular Weight: 37 kDa (MW of target protein)