CPEB2 antibody (Middle Region)
-
- Target See all CPEB2 Antibodies
- CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CPEB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CPEB2 antibody was raised against the middle region of CPEB2
- Purification
- Purified
- Immunogen
- CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL
- Top Product
- Discover our top product CPEB2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CPEB2 Blocking Peptide, catalog no. 33R-2191, is also available for use as a blocking control in assays to test for specificity of this CPEB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))
- Alternative Name
- CPEB2 (CPEB2 Products)
- Background
- CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.
- Molecular Weight
- 37 kDa (MW of target protein)
-