DAZAP1 antibody (C-Term)

Catalog No. ABIN629929

Product Details anti-DAZAP1 Antibody

Target: DAZAP1 (DAZ Associated Protein 1 (DAZAP1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAZAP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: DAZAP1 antibody was raised against the C terminal of DAZAP1

Purification: Purified

Immunogen: DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids GFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAZAP1 Blocking Peptide, catalog no. 33R-3258, is also available for use as a blocking control in assays to test for specificity of this DAZAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAZAP1

Target: DAZAP1 (DAZ Associated Protein 1 (DAZAP1))

Alternative Name: DAZAP1 (DAZAP1 Products)

Synonyms: MGC89358 antibody, DAZAP1 antibody, 2410042M16Rik antibody, mPrrp antibody, DAZ associated protein 1 antibody, DAZ associated protein 1 L homeolog antibody, dazap1 antibody, DAZAP1 antibody, Dazap1 antibody, dazap1.L antibody

Background: In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. DAZAP1 is a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL.

Molecular Weight: 45 kDa (MW of target protein)