DRB1 antibody (N-Term)
-
- Target See all DRB1 products
- DRB1 (Dopamine Receptor Binding 1 (DRB1))
- Binding Specificity
- N-Term
-
Reactivity
- Dog, Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DRB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DRB1 antibody was raised against the N terminal of DRB1
- Purification
- Purified
- Immunogen
- DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DRB1 Blocking Peptide, catalog no. 33R-5829, is also available for use as a blocking control in assays to test for specificity of this DRB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DRB1 (Dopamine Receptor Binding 1 (DRB1))
- Alternative Name
- DRB1 (DRB1 Products)
- Synonyms
- dopamine receptor binding 1 antibody, Drb1 antibody
- Background
- DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- TCR Signaling, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events
-