CPSF3 antibody (C-Term)

Catalog No. ABIN629924

Product Details anti-CPSF3 Antibody

Target: CPSF3 (Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPSF3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CPSF3 antibody was raised against the C terminal of CPSF3

Purification: Purified

Immunogen: CPSF3 antibody was raised using the C terminal of CPSF3 corresponding to a region with amino acids DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPSF3 Blocking Peptide, catalog no. 33R-1889, is also available for use as a blocking control in assays to test for specificity of this CPSF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPSF3

Target: CPSF3 (Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3))

Alternative Name: CPSF3 (CPSF3 Products)

Synonyms: CPSF3 antibody, si:dkey-81b15.1 antibody, wu:fc32f10 antibody, zgc:101655 antibody, CPSF-73 antibody, CPSF73 antibody, cleavage and polyadenylation specific factor 3 antibody, cleavage and polyadenylation specificity factor subunit 3 antibody, cleavage and polyadenylation specific factor 3 L homeolog antibody, cleavage and polyadenylation specific factor 3, 73kDa antibody, cleavage and polyadenylation specificity factor 3 antibody, CPSF3 antibody, cpsf3 antibody, CpipJ_CPIJ011955 antibody, CMU_024380 antibody, PITG_07110 antibody, cpsf3.L antibody, Cpsf3 antibody

Background: CPSF3 belongs to the RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily. It is component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition.

Molecular Weight: 75 kDa (MW of target protein)