CDKN2AIP antibody (C-Term)

Catalog No. ABIN629922

Product Details anti-CDKN2AIP Antibody

Target: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDKN2AIP antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CARF antibody was raised against the C terminal Of Carf

Purification: Purified

Immunogen: CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS

Application Details

Application Notes: WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CARF Blocking Peptide, catalog no. 33R-1263, is also available for use as a blocking control in assays to test for specificity of this CARF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDKN2AIP

Target: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Alternative Name: CARF (CDKN2AIP Products)

Synonyms: CARF antibody, 4921511I16Rik antibody, AW208986 antibody, CDKN2AIP antibody, RGD1305302 antibody, CDKN2A interacting protein antibody, CDKN2A interacting protein L homeolog antibody, CDKN2AIP antibody, Cdkn2aip antibody, cdkn2aip antibody, cdkn2aip.L antibody

Background: CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.

Molecular Weight: 64 kDa (MW of target protein)